PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00593.110
Common NameJCGZ_26442, LOC105648793
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YC
Protein Properties Length: 198aa    MW: 21311.7 Da    PI: 4.7337
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00593.110genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC45.61.5e-144178135
           NF-YC  1 qlksfwekq...iekatdfknhelPlarikkilkaded 35
                    ql++fw++q   ie+++dfknh+lPlarikki+kaded
  Jcr4S00593.110 41 QLQMFWSYQrqeIEQVNDFKNHQLPLARIKKIMKADED 78
                    89*****998899***********************98 PP

2NF-YC44.43.7e-147811367102
           NF-YC  67 eenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
                     +enkrrtl+k+diaaa+trtdifdflvdivprde+k
  Jcr4S00593.110  78 DENKRRTLQKNDIAAAITRTDIFDFLVDIVPRDEIK 113
                     69*******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471138.6E-1515103IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.6E-85578IPR009072Histone-fold
Gene3DG3DSA:1.10.20.107.4E-1079109IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MDANSQQAQS ASYPPQAPTT GAPAPPAPTP FHHLLQQQQQ QLQMFWSYQR QEIEQVNDFK  60
NHQLPLARIK KIMKADEDEN KRRTLQKNDI AAAITRTDIF DFLVDIVPRD EIKDEAGLGG  120
MVGATASGVP YYYPPMGQPT GAGPGGMMIG RPAVDPTGVY VQPPSQAWQS VWQTAAAAED  180
GSYGSGGSSG QGNLDGQG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18187RRTLQKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090689.11e-106PREDICTED: nuclear transcription factor Y subunit C-1 isoform X1
RefseqXP_012090690.11e-106PREDICTED: nuclear transcription factor Y subunit C-1 isoform X1
RefseqXP_012090691.11e-106PREDICTED: nuclear transcription factor Y subunit C-1 isoform X2
SwissprotQ9SMP05e-80NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
TrEMBLA0A067JFC21e-106A0A067JFC2_JATCU; Uncharacterized protein
STRINGPOPTR_0015s10940.13e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110713038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.13e-78nuclear factor Y, subunit C1
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]